PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053893.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 128aa    MW: 14967.8 Da    PI: 9.7819
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053893.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.62.8e-10741092055
                   HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
      Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                   +k +yp+++++  LAk++gL+++q+ +WF N+R ++
  EcC053893.60  74 NKWPYPTEADKIALAKSTGLDQKQINNWFINQRKRH 109
                   4679*****************************985 PP

2ELK29.51.7e-102950122
           ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                  +LK++LlrK++ ++++Lk EFs
  EcC053893.60 29 DLKDRLLRKFGNHISTLKLEFS 50
                  69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037896.0E-72950IPR005539ELK domain
SMARTSM011886.9E-52950IPR005539ELK domain
PROSITE profilePS512139.6382949IPR005539ELK domain
PROSITE profilePS5007112.82749112IPR001356Homeobox domain
SuperFamilySSF466895.13E-2050123IPR009057Homeodomain-like
SMARTSM003894.5E-1451116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-2854114IPR009057Homeodomain-like
CDDcd000864.95E-1261113No hitNo description
PfamPF059201.4E-1769108IPR008422Homeobox KN domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
NEGDVSSDED FSGGEVEAPE TQPRGEDRDL KDRLLRKFGN HISTLKLEFS KKKKKGKLPK  60
EARQTLLEWW NVHNKWPYPT EADKIALAKS TGLDQKQINN WFINQRKRHW KPSENMQFAL  120
MDSIPGQY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010023500.12e-89PREDICTED: homeobox protein knotted-1-like 6
RefseqXP_010023501.12e-89PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS63e-61KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A059B1M51e-89A0A059B1M5_EUCGR; Uncharacterized protein
STRINGVIT_01s0127g00210.t019e-63(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.27e-54KNOTTED1-like homeobox gene 6